Plant Transcription Factor Database
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C006887P1
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family HD-ZIP
Protein Properties Length: 752aa    MW: 82947.2 Da    PI: 5.7435
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
        Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     r+k +++t++q++eLe +F+++++p+ ++r eL+++lgL+++qVk+WFqNrR+++k
                     7999*************************************************999 PP

           START   2 laeeaaqelvkkalaeepgWvkss.....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaetl 82 
                     la++a++elvk+a+ + p+W +         +n de+ ++f++s +      ++ea r++++v+ ++  lve+l+d + +W e+++    +a+t+
                     6899******************99998888999********99988**9999**************************.**************** PP

           START  83 evissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehv 170
                     +vissg      galqlm ael +lsplvp R   f+R+++q+ +g w++vdvS+ + ++ +   s+  +++lpSg+++++++ng skvtwveh+
                     **********************************************************9965...8***************************** PP

           START 171 dlkgrlphwllrslvksglaegaktwvatlqrqce 205
                     ++++ ++h+l+r+l++sg  +g ++w+atlqrqc 
                     *********************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007117.49152112IPR001356Homeobox domain
SMARTSM003894.3E-2054116IPR001356Homeobox domain
CDDcd000862.66E-2055112No hitNo description
PfamPF000467.5E-1955110IPR001356Homeobox domain
PROSITE patternPS00027087110IPR017970Homeobox, conserved site
PROSITE profilePS5084839.55253487IPR002913START domain
SuperFamilySSF559612.47E-29254484No hitNo description
SMARTSM002345.1E-34262484IPR002913START domain
CDDcd088751.05E-110262482No hitNo description
PfamPF018526.3E-47263483IPR002913START domain
SuperFamilySSF559613.43E-17512745No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 752 aa     Download sequence    Send to blast
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818480.0LN681848.1 Cucumis melo genomic scaffold, anchoredscaffold00006.
GenBankLN7132600.0LN713260.1 Cucumis melo genomic chromosome, chr_6.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008439184.10.0PREDICTED: homeobox-leucine zipper protein ANTHOCYANINLESS 2 isoform X1
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLA0A0A0L5U50.0A0A0A0L5U5_CUCSA; Uncharacterized protein
STRINGGLYMA10G38280.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein